SCOPe 2.08: Domain d5tw2a2: 5tw2 A:186-279

Lineage for d5tw2a2 (5tw2 A:186-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5tw2a2: 5tw2 A:186-279 [339316]
   Other proteins in same PDB: d5tw2a1, d5tw2b_
   automated match to d1zt4c1
   complexed with 7lp, nag, plm

Details for d5tw2a2

PDB Entry: 5tw2, 1.75 Å

PDB Description: structure of mouse cd1d with bound alpha-galactosylsphingamide jg168

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d5tw2a2:

Sequence, based on SEQRES records:

>d5tw2a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d5tw2a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw

Timeline for d5tw2a2:

• d5tw2a2 first appeared in SCOPe 2.06
  
• d5tw2a2 appears in SCOPe 2.07