| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d5tw2a2: 5tw2 A:186-279 [339316] Other proteins in same PDB: d5tw2a1, d5tw2b_ automated match to d1zt4c1 complexed with 7lp, nag, plm |
PDB Entry: 5tw2 (more details), 1.75 Å
SCOPe Domain Sequences for d5tw2a2:
Sequence, based on SEQRES records: (download)
>d5tw2a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw
>d5tw2a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw
Timeline for d5tw2a2: