SCOPe 2.05: Domain d1digb2: 1dig B:1002-1126

Lineage for d1digb2 (1dig B:1002-1126)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein)
   automatically mapped to Pfam PF00763

6. Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
   the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated

7. Species Human (Homo sapiens) [TaxId:9606] [53237] (4 PDB entries)

8. Domain d1digb2: 1dig B:1002-1126 [33931]
   Other proteins in same PDB: d1diga1, d1digb1
   complexed with act, l37, nap

Details for d1digb2

PDB Entry: 1dig, 2.2 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly374571

PDB Compounds: (B:) methylenetetrahydrofolate dehydrogenase / cyclohydrolase

SCOPe Domain Sequences for d1digb2:

Sequence; same for both SEQRES and ATOM records:

>d1digb2 c.58.1.2 (B:1002-1126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

Timeline for d1digb2:

• d1digb2 first appeared (with stable ids) in SCOP 1.55
  
• d1digb2 appears in SCOPe 2.04
  
• d1digb2 appears in SCOPe 2.06
  
• d1digb2 appears in the current release, SCOPe 2.08