Lineage for d5tcwa_ (5tcw A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404606Family b.82.2.1: Penicillin synthase-like [51198] (5 protein domains)
    common fold is rather distorted
  6. 2404607Protein 1-aminocyclopropane-1-carboxylate oxidase 1 [141621] (1 species)
  7. 2404608Species Petunia hybrida [TaxId:4102] [141622] (3 PDB entries)
    Uniprot Q08506 2-308
  8. 2404611Domain d5tcwa_: 5tcw A: [339301]
    automated match to d1w9ya1
    complexed with act, ni

Details for d5tcwa_

PDB Entry: 5tcw (more details), 2.7 Å

PDB Description: acc oxidase complex with nickel and acetate
PDB Compounds: (A:) 1-aminocyclopropane-1-carboxylate oxidase 1

SCOPe Domain Sequences for d5tcwa_:

Sequence, based on SEQRES records: (download)

>d5tcwa_ b.82.2.1 (A:) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakeprf
eamkame

Sequence, based on observed residues (ATOM records): (download)

>d5tcwa_ b.82.2.1 (A:) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]}
enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
garmslasfynpgsdaviypapalvqvypkfvfddymklyaglkfqakeprfeamkame

SCOPe Domain Coordinates for d5tcwa_:

Click to download the PDB-style file with coordinates for d5tcwa_.
(The format of our PDB-style files is described here.)

Timeline for d5tcwa_: