Lineage for d1diga2 (1dig A:2-126)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610171Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein)
    automatically mapped to Pfam PF00763
  6. 1610172Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. 1610178Species Human (Homo sapiens) [TaxId:9606] [53237] (4 PDB entries)
  8. 1610181Domain d1diga2: 1dig A:2-126 [33930]
    Other proteins in same PDB: d1diga1, d1digb1
    complexed with act, l37, nap

Details for d1diga2

PDB Entry: 1dig (more details), 2.2 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly374571
PDB Compounds: (A:) methylenetetrahydrofolate dehydrogenase / cyclohydrolase

SCOPe Domain Sequences for d1diga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diga2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

SCOPe Domain Coordinates for d1diga2:

Click to download the PDB-style file with coordinates for d1diga2.
(The format of our PDB-style files is described here.)

Timeline for d1diga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diga1