Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins) common fold is rather distorted |
Protein 1-aminocyclopropane-1-carboxylate oxidase 1 [141621] (1 species) |
Species Petunia hybrida [TaxId:4102] [141622] (3 PDB entries) Uniprot Q08506 2-308 |
Domain d5tcva_: 5tcv A: [339298] automated match to d1w9ya1 complexed with 1ac, ni |
PDB Entry: 5tcv (more details), 2.6 Å
SCOPe Domain Sequences for d5tcva_:
Sequence, based on SEQRES records: (download)
>d5tcva_ b.82.2.1 (A:) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]} nfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcme qrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrle klaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdagg iillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkdg armslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakeprfe amkame
>d5tcva_ b.82.2.1 (A:) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]} nfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcme qrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrle klaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdagg iillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkdg armslasfynpgsdaviypapalvekqvypkfvfddymklyaglkfqakeprfeamkame
Timeline for d5tcva_: