Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries) |
Domain d5nvzl_: 5nvz L: [339289] Other proteins in same PDB: d5nvza_, d5nvzb1, d5nvzb2, d5nvzd_, d5nvze1, d5nvze2, d5nvzg_, d5nvzh1, d5nvzh2, d5nvzj_, d5nvzk1, d5nvzk2 automated match to d1lqbc_ complexed with 9bn |
PDB Entry: 5nvz (more details), 2.7 Å
SCOPe Domain Sequences for d5nvzl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvzl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqe
Timeline for d5nvzl_: