Lineage for d1diaa2 (1dia A:2-126)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72517Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 72518Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 72598Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein)
  6. 72599Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
  7. 72605Species Human (Homo sapiens) [TaxId:9606] [53237] (4 PDB entries)
  8. 72608Domain d1diaa2: 1dia A:2-126 [33928]
    Other proteins in same PDB: d1diaa1, d1diab1

Details for d1diaa2

PDB Entry: 1dia (more details), 2.2 Å

PDB Description: human methylenetetrahydrofolate dehydrogenase / cyclohydrolase complexed with nadp and inhibitor ly249543

SCOP Domain Sequences for d1diaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diaa2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens)}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

SCOP Domain Coordinates for d1diaa2:

Click to download the PDB-style file with coordinates for d1diaa2.
(The format of our PDB-style files is described here.)

Timeline for d1diaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diaa1