Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries) |
Domain d5nvzg_: 5nvz G: [339274] Other proteins in same PDB: d5nvzb1, d5nvzb2, d5nvzc_, d5nvze1, d5nvze2, d5nvzf_, d5nvzh1, d5nvzh2, d5nvzi_, d5nvzk1, d5nvzk2, d5nvzl_ automated match to d1lqba_ complexed with 9bn |
PDB Entry: 5nvz (more details), 2.7 Å
SCOPe Domain Sequences for d5nvzg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvzg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d5nvzg_: