Lineage for d5nvzg_ (5nvz G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177238Protein Elongin B [54246] (2 species)
  7. 2177239Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2177358Domain d5nvzg_: 5nvz G: [339274]
    Other proteins in same PDB: d5nvzb1, d5nvzb2, d5nvzc_, d5nvze1, d5nvze2, d5nvzf_, d5nvzh1, d5nvzh2, d5nvzi_, d5nvzk1, d5nvzk2, d5nvzl_
    automated match to d1lqba_
    complexed with 9bn

Details for d5nvzg_

PDB Entry: 5nvz (more details), 2.7 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-(1- acetylcyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4- (4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 16)
PDB Compounds: (G:) Elongin-B

SCOPe Domain Sequences for d5nvzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvzg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d5nvzg_:

Click to download the PDB-style file with coordinates for d5nvzg_.
(The format of our PDB-style files is described here.)

Timeline for d5nvzg_: