Lineage for d1a4ib2 (1a4i B:2-126)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25725Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (1 protein)
  6. 25726Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
  7. 25732Species Human (Homo sapiens) [TaxId:9606] [53237] (4 PDB entries)
  8. 25734Domain d1a4ib2: 1a4i B:2-126 [33927]
    Other proteins in same PDB: d1a4ia1, d1a4ib1

Details for d1a4ib2

PDB Entry: 1a4i (more details), 1.5 Å

PDB Description: human tetrahydrofolate dehydrogenase / cyclohydrolase

SCOP Domain Sequences for d1a4ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4ib2 c.58.1.2 (B:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens)}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

SCOP Domain Coordinates for d1a4ib2:

Click to download the PDB-style file with coordinates for d1a4ib2.
(The format of our PDB-style files is described here.)

Timeline for d1a4ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a4ib1