Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries) |
Domain d5nw1a_: 5nw1 A: [339259] Other proteins in same PDB: d5nw1b1, d5nw1b2, d5nw1c_, d5nw1e1, d5nw1e2, d5nw1f_, d5nw1h1, d5nw1h2, d5nw1i_, d5nw1k1, d5nw1k2, d5nw1l_ automated match to d1lqba_ complexed with 9bh |
PDB Entry: 5nw1 (more details), 2.1 Å
SCOPe Domain Sequences for d5nw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nw1a_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
Timeline for d5nw1a_: