SCOPe 2.07: Domain d5nvvf_: 5nvv F:

Lineage for d5nvvf_ (5nvv F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)
   automatically mapped to Pfam PF01847

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)

8. Domain d5nvvf_: 5nvv F: [339250]
   Other proteins in same PDB: d5nvva_, d5nvvb1, d5nvvb2, d5nvvd_, d5nvve1, d5nvve2, d5nvvg_, d5nvvh1, d5nvvh2, d5nvvj_, d5nvvk1, d5nvvk2
   automated match to d1lqbc_
   complexed with 9bt

Details for d5nvvf_

PDB Entry: 5nvv, 2.1 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-4-hydroxy-1-((s)-2-(2- hydroxyacetamido)-3,3-dimethylbutanoyl)-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)

PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5nvvf_:

Sequence; same for both SEQRES and ATOM records:

>d5nvvf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

Timeline for d5nvvf_:

• d5nvvf_ first appeared in SCOPe 2.06
  
• d5nvvf_ appears in the current release, SCOPe 2.08