Class b: All beta proteins [48724] (178 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries) |
Domain d5nvvf_: 5nvv F: [339250] Other proteins in same PDB: d5nvva_, d5nvvb1, d5nvvb2, d5nvvd_, d5nvve1, d5nvve2, d5nvvg_, d5nvvh1, d5nvvh2, d5nvvj_, d5nvvk1, d5nvvk2 automated match to d1lqbc_ complexed with 9bt |
PDB Entry: 5nvv (more details), 2.1 Å
SCOPe Domain Sequences for d5nvvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvvf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqe
Timeline for d5nvvf_: