Lineage for d1bxga2 (1bxg A:1-148)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398612Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 398613Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 398614Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 398720Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 398721Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 398728Domain d1bxga2: 1bxg A:1-148 [33924]
    Other proteins in same PDB: d1bxga1, d1bxgb1

Details for d1bxga2

PDB Entry: 1bxg (more details), 2.3 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and beta-phenylpropionate

SCOP Domain Sequences for d1bxga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxga2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
sidsalnwdgemtvtrfdsktgahfvirldstqlgpaaggtraaqysqladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOP Domain Coordinates for d1bxga2:

Click to download the PDB-style file with coordinates for d1bxga2.
(The format of our PDB-style files is described here.)

Timeline for d1bxga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxga1