Lineage for d5nvwf_ (5nvw F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041663Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2041664Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2041665Protein VHL [49470] (1 species)
  7. 2041666Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries)
  8. 2041725Domain d5nvwf_: 5nvw F: [339235]
    Other proteins in same PDB: d5nvwa_, d5nvwb1, d5nvwb2, d5nvwd_, d5nvwe1, d5nvwe2, d5nvwg_, d5nvwh1, d5nvwh2, d5nvwj_, d5nvwk1, d5nvwk2
    automated match to d1lqbc_
    complexed with 9bw

Details for d5nvwf_

PDB Entry: 5nvw (more details), 2.2 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- (cyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4- methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5nvwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvwf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d5nvwf_:

Click to download the PDB-style file with coordinates for d5nvwf_.
(The format of our PDB-style files is described here.)

Timeline for d5nvwf_: