Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d5nvwf_: 5nvw F: [339235] Other proteins in same PDB: d5nvwa_, d5nvwb1, d5nvwb2, d5nvwd_, d5nvwe1, d5nvwe2, d5nvwg_, d5nvwh1, d5nvwh2, d5nvwj_, d5nvwk1, d5nvwk2 automated match to d1lqbc_ complexed with 9bw |
PDB Entry: 5nvw (more details), 2.2 Å
SCOPe Domain Sequences for d5nvwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvwf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqe
Timeline for d5nvwf_: