| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
| Family b.3.3.1: VHL [49469] (2 proteins) |
| Protein VHL [49470] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
| Domain d5nw1i_: 5nw1 I: [339230] Other proteins in same PDB: d5nw1a_, d5nw1b1, d5nw1b2, d5nw1d_, d5nw1e1, d5nw1e2, d5nw1g_, d5nw1h1, d5nw1h2, d5nw1j_, d5nw1k1, d5nw1k2 automated match to d1lqbc_ complexed with 9bh |
PDB Entry: 5nw1 (more details), 2.1 Å
SCOPe Domain Sequences for d5nw1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nw1i_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe
Timeline for d5nw1i_: