Lineage for d5nw1i_ (5nw1 I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768837Domain d5nw1i_: 5nw1 I: [339230]
    Other proteins in same PDB: d5nw1a_, d5nw1b1, d5nw1b2, d5nw1d_, d5nw1e1, d5nw1e2, d5nw1g_, d5nw1h1, d5nw1h2, d5nw1j_, d5nw1k1, d5nw1k2
    automated match to d1lqbc_
    complexed with 9bh

Details for d5nw1i_

PDB Entry: 5nw1 (more details), 2.1 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2- (cyclobutanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4- methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 18)
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5nw1i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nw1i_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d5nw1i_:

Click to download the PDB-style file with coordinates for d5nw1i_.
(The format of our PDB-style files is described here.)

Timeline for d5nw1i_: