Lineage for d1bw9b2 (1bw9 B:401-548)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587802Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 587803Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 587804Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 587917Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 587918Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 587924Domain d1bw9b2: 1bw9 B:401-548 [33923]
    Other proteins in same PDB: d1bw9a1, d1bw9b1
    complexed with 1py, edo, ipa, k, na, nad, po4

Details for d1bw9b2

PDB Entry: 1bw9 (more details), 1.5 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate

SCOP Domain Sequences for d1bw9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw9b2 c.58.1.1 (B:401-548) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
sidsalnwdgemtvtrfdkmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOP Domain Coordinates for d1bw9b2:

Click to download the PDB-style file with coordinates for d1bw9b2.
(The format of our PDB-style files is described here.)

Timeline for d1bw9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bw9b1