Lineage for d1bw9b2 (1bw9 B:401-548)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489479Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 489480Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 489481Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 489587Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 489588Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 489594Domain d1bw9b2: 1bw9 B:401-548 [33923]
    Other proteins in same PDB: d1bw9a1, d1bw9b1

Details for d1bw9b2

PDB Entry: 1bw9 (more details), 1.5 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate

SCOP Domain Sequences for d1bw9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw9b2 c.58.1.1 (B:401-548) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
sidsalnwdgemtvtrfdkmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOP Domain Coordinates for d1bw9b2:

Click to download the PDB-style file with coordinates for d1bw9b2.
(The format of our PDB-style files is described here.)

Timeline for d1bw9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bw9b1