Lineage for d1bw9a2 (1bw9 A:1-148)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998236Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 998237Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 998238Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 998351Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 998352Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 998357Domain d1bw9a2: 1bw9 A:1-148 [33922]
    Other proteins in same PDB: d1bw9a1, d1bw9b1
    complexed with edo, ipa, k, na, nad, po4, ppy

Details for d1bw9a2

PDB Entry: 1bw9 (more details), 1.5 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate
PDB Compounds: (A:) phenylalanine dehydrogenase

SCOPe Domain Sequences for d1bw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw9a2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysnladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOPe Domain Coordinates for d1bw9a2:

Click to download the PDB-style file with coordinates for d1bw9a2.
(The format of our PDB-style files is described here.)

Timeline for d1bw9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bw9a1