SCOPe 2.02: Domain d1c1xa2: 1c1x A:1-148

Lineage for d1c1xa2 (1c1x A:1-148)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Phenylalanine dehydrogenase [53233] (1 species)

7. Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)

8. Domain d1c1xa2: 1c1x A:1-148 [33920]
   Other proteins in same PDB: d1c1xa1, d1c1xb1
   complexed with hfa, ipa, k, na, nad, po4

Details for d1c1xa2

PDB Entry: 1c1x, 1.4 Å

PDB Description: l-phenylalanine dehydrogenase structure in ternary complex with nad+ and l-3-phenyllactate

PDB Compounds: (A:) l-phenylalanine dehydrogenase

SCOPe Domain Sequences for d1c1xa2:

Sequence; same for both SEQRES and ATOM records:

>d1c1xa2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysnladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

Timeline for d1c1xa2:

• d1c1xa2 first appeared (with stable ids) in SCOP 1.55
  
• d1c1xa2 appears in SCOPe 2.01
  
• d1c1xa2 appears in SCOPe 2.03
  
• d1c1xa2 appears in the current release, SCOPe 2.08