SCOPe 2.06: Domain d5nyza_: 5nyz A:

Lineage for d5nyza_ (5nyz A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries)

8. Domain d5nyza_: 5nyz A: [339199]
   automated match to d3zeza_
   complexed with dup, mg; mutant

Details for d5nyza_

PDB Entry: 5nyz, 2.5 Å

PDB Description: twist and induce: dissecting the link between the enzymatic activity and the sapi inducing capacity of the phage 80 dutpase. d95e mutant from dutpase 80alpha phage.

PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d5nyza_:

Sequence, based on SEQRES records:

>d5nyza_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
mtntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgl
ltsrsgvsskthlvietgkidagyhgnlginikneheddkmqtiflrnidnekifekerh
lyklgsyriekgeriaqlvivpiwtpelkqveefesvsergekgfgss

Sequence, based on observed residues (ATOM records):

>d5nyza_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
mtntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgl
ltsrsgvsskthlvietgkidagyhgnlginikneheddkmqtiflrnidnekifekerh
lyklgsyriekgeriaqlvivpiwtpelkqveefesvergekgfgss

Timeline for d5nyza_:

• d5nyza_ is new in SCOPe 2.06-stable
  
• d5nyza_ appears in SCOPe 2.07
  
• d5nyza_ appears in the current release, SCOPe 2.08