Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries) |
Domain d5nvxg_: 5nvx G: [339176] Other proteins in same PDB: d5nvxb1, d5nvxb2, d5nvxc_, d5nvxe1, d5nvxe2, d5nvxf_, d5nvxh1, d5nvxh2, d5nvxi_, d5nvxk1, d5nvxk2, d5nvxl_ automated match to d1lqba_ complexed with 4yy |
PDB Entry: 5nvx (more details), 2.2 Å
SCOPe Domain Sequences for d5nvxg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvxg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d5nvxg_: