Lineage for d1lehb2 (1leh B:1-134)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587802Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 587803Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 587804Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 587913Protein Leucine dehydrogenase [53231] (1 species)
  7. 587914Species Bacillus sphaericus [TaxId:1421] [53232] (1 PDB entry)
  8. 587916Domain d1lehb2: 1leh B:1-134 [33917]
    Other proteins in same PDB: d1leha1, d1lehb1

Details for d1lehb2

PDB Entry: 1leh (more details), 2.2 Å

PDB Description: leucine dehydrogenase from bacillus sphaericus

SCOP Domain Sequences for d1lehb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lehb2 c.58.1.1 (B:1-134) Leucine dehydrogenase {Bacillus sphaericus}
meifkymekydyeqlvfcqdeasglkaviaihdttlgpalggarmwtynaeeeaiedalr
largmtyknaaaglnlgggktviigdpfadknedmfralgrfiqglngryitaedvgttv
ddmdlihqetdyvt

SCOP Domain Coordinates for d1lehb2:

Click to download the PDB-style file with coordinates for d1lehb2.
(The format of our PDB-style files is described here.)

Timeline for d1lehb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lehb1