Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein Leucine dehydrogenase [53231] (1 species) |
Species Bacillus sphaericus [TaxId:1421] [53232] (1 PDB entry) |
Domain d1leha2: 1leh A:1-134 [33916] Other proteins in same PDB: d1leha1, d1lehb1 |
PDB Entry: 1leh (more details), 2.2 Å
SCOP Domain Sequences for d1leha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus} meifkymekydyeqlvfcqdeasglkaviaihdttlgpalggarmwtynaeeeaiedalr largmtyknaaaglnlgggktviigdpfadknedmfralgrfiqglngryitaedvgttv ddmdlihqetdyvt
Timeline for d1leha2: