Lineage for d1hwyf2 (1hwy F:1-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890285Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2890293Species Cow (Bos taurus) [TaxId:9913] [53230] (6 PDB entries)
  8. 2890308Domain d1hwyf2: 1hwy F:1-208 [33915]
    Other proteins in same PDB: d1hwya1, d1hwyb1, d1hwyc1, d1hwyd1, d1hwye1, d1hwyf1
    complexed with akg, nad, po4

Details for d1hwyf2

PDB Entry: 1hwy (more details), 3.2 Å

PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate
PDB Compounds: (F:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwyf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwyf2 c.58.1.1 (F:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d1hwyf2:

Click to download the PDB-style file with coordinates for d1hwyf2.
(The format of our PDB-style files is described here.)

Timeline for d1hwyf2: