Lineage for d1hwye2 (1hwy E:1-208)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998236Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 998237Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 998238Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 998239Protein Glutamate dehydrogenase [53225] (8 species)
  7. 998247Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
  8. 998264Domain d1hwye2: 1hwy E:1-208 [33914]
    Other proteins in same PDB: d1hwya1, d1hwyb1, d1hwyc1, d1hwyd1, d1hwye1, d1hwyf1
    complexed with akg, nad, po4

Details for d1hwye2

PDB Entry: 1hwy (more details), 3.2 Å

PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate
PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwye2 c.58.1.1 (E:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d1hwye2:

Click to download the PDB-style file with coordinates for d1hwye2.
(The format of our PDB-style files is described here.)

Timeline for d1hwye2: