Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d5nvxh1: 5nvx H:17-112 [339137] Other proteins in same PDB: d5nvxa_, d5nvxb2, d5nvxc_, d5nvxd_, d5nvxe2, d5nvxf_, d5nvxg_, d5nvxh2, d5nvxi_, d5nvxj_, d5nvxk2, d5nvxl_ automated match to d1lm8c_ complexed with 4yy |
PDB Entry: 5nvx (more details), 2.2 Å
SCOPe Domain Sequences for d5nvxh1:
Sequence, based on SEQRES records: (download)
>d5nvxh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d5nvxh1 d.42.1.1 (H:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt nssteipefpiapeialellmaanfldc
Timeline for d5nvxh1: