Lineage for d5ohka_ (5ohk A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 2498073Species Human (Homo sapiens) [TaxId:9606] [187072] (48 PDB entries)
  8. 2498133Domain d5ohka_: 5ohk A: [339133]
    Other proteins in same PDB: d5ohkb_
    automated match to d2ibia1
    complexed with aye, zn

Details for d5ohka_

PDB Entry: 5ohk (more details), 2.34 Å

PDB Description: crystal structure of usp30 in covalent complex with ubiquitin propargylamide (high resolution)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 30,Ubiquitin carboxyl-terminal hydrolase 30,Ubiquitin carboxyl-terminal hydrolase 30

SCOPe Domain Sequences for d5ohka_:

Sequence, based on SEQRES records: (download)

>d5ohka_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kglvpglvnlgntcfmnsllqglsacpafirwleeftsqysrdqkeppshqylsltllhl
lkalscqevtddevldasclldvlrmyrwqissfeeqdahelfhvitsslederdgsgsh
wksqhpfhgrltsnmvckhcehqspvrfdtfdslslsipaatwghpltldhclhhfisse
svrdvvcdnctkieakgtlngekvehqrttfvkqlklgklpqclcihlqrlswsshgtpl
krhehvqfnedlsmdeykyhsnastylfrlmavvvhhgdmhsghfvtyrrsppsarnpls
tsnqwlwvsddtvrkaslqevlsssayllfyerv

Sequence, based on observed residues (ATOM records): (download)

>d5ohka_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kglvpglvnlgntcfmnsllqglsacpafirwleeftsqysrqylsltllhllkalscqe
vtddevldasclldvlrmyrwqissfeeqdahelfhvitsslederdgsgshwksqhpfh
grltsnmvckhcehqspvrfdtfdslslsipaatwghpltldhclhhfissesvrdvvcd
nctkrttfvkqlklgklpqclcihlqrlswsshgtplkrhehvqfnedlsmdeykyhsna
stylfrlmavvvhhgdmhsghfvtyrrsppssnqwlwvsddtvrkaslqevlsssayllf
yerv

SCOPe Domain Coordinates for d5ohka_:

Click to download the PDB-style file with coordinates for d5ohka_.
(The format of our PDB-style files is described here.)

Timeline for d5ohka_: