SCOPe 2.07: Domain d5lxsa2: 5lxs A:246-437

Lineage for d5lxsa2 (5lxs A:246-437)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

8. Domain d5lxsa2: 5lxs A:246-437 [339129]
   Other proteins in same PDB: d5lxsa1, d5lxsb1, d5lxsc1, d5lxsd1, d5lxse_, d5lxsf1, d5lxsf2, d5lxsf3
   automated match to d4i50a2
   complexed with 7ao, acp, ca, gdp, gtp, mes, mg

Details for d5lxsa2

PDB Entry: 5lxs, 2.2 Å

PDB Description: tubulin-ks-1-199-32 complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5lxsa2:

Sequence, based on SEQRES records:

>d5lxsa2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Sequence, based on observed residues (ATOM records):

>d5lxsa2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekaqlsvaeitnacfepanqmvkcdpr
hgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggdl
akvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaal
ekdyeevgv

Timeline for d5lxsa2:

• d5lxsa2 first appeared in SCOPe 2.06
  
• d5lxsa2 appears in the current release, SCOPe 2.08