SCOPe 2.01: Domain d1hwyc2: 1hwy C:1-208

Lineage for d1hwyc2 (1hwy C:1-208)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
Protein Glutamate dehydrogenase [53225] (8 species)
Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
Domain d1hwyc2: 1hwy C:1-208 [33912]
Other proteins in same PDB: d1hwya1, d1hwyb1, d1hwyc1, d1hwyd1, d1hwye1, d1hwyf1
complexed with akg, nad, po4

Details for d1hwyc2

PDB Entry: 1hwy (more details), 3.2 Å

PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate

PDB Compounds: (C:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwyc2 c.58.1.1 (C:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d1hwyc2:

Click to download the PDB-style file with coordinates for d1hwyc2.
(The format of our PDB-style files is described here.)

Timeline for d1hwyc2: