Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein Glutamate dehydrogenase [53225] (8 species) |
Species Cow (Bos taurus) [TaxId:9913] [53230] (6 PDB entries) |
Domain d1hwyc2: 1hwy C:1-208 [33912] Other proteins in same PDB: d1hwya1, d1hwyb1, d1hwyc1, d1hwyd1, d1hwye1, d1hwyf1 complexed with akg, nad, po4 |
PDB Entry: 1hwy (more details), 3.2 Å
SCOPe Domain Sequences for d1hwyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwyc2 c.58.1.1 (C:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia dtyastighydinahacvtgkpisqggi
Timeline for d1hwyc2: