Lineage for d5mf4f2 (5mf4 F:77-378)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217619Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2217620Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2217621Species Chicken (Gallus gallus) [TaxId:9031] [311385] (39 PDB entries)
  8. 2217645Domain d5mf4f2: 5mf4 F:77-378 [339109]
    Other proteins in same PDB: d5mf4a1, d5mf4a2, d5mf4b1, d5mf4b2, d5mf4c1, d5mf4c2, d5mf4d1, d5mf4d2, d5mf4e_, d5mf4f1, d5mf4f3
    automated match to d3tiia2
    complexed with 7lz, acp, ca, gdp, gol, gtp, mes, mg

Details for d5mf4f2

PDB Entry: 5mf4 (more details), 2.3 Å

PDB Description: tubulin-dictyostatin complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5mf4f2:

Sequence, based on SEQRES records: (download)

>d5mf4f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5mf4f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptderevflaaynrrregregnvwiakgilissea
selldfidvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtspynsdk
tchltnhciqkygryeegnemffeefnqylmdalnttlensillqikhiirsclmciepa
istkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpl
atsifikl

SCOPe Domain Coordinates for d5mf4f2:

Click to download the PDB-style file with coordinates for d5mf4f2.
(The format of our PDB-style files is described here.)

Timeline for d5mf4f2: