| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
| Family b.3.3.1: VHL [49469] (2 proteins) |
| Protein VHL [49470] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
| Domain d5nvxc_: 5nvx C: [339107] Other proteins in same PDB: d5nvxa_, d5nvxb1, d5nvxb2, d5nvxd_, d5nvxe1, d5nvxe2, d5nvxg_, d5nvxh1, d5nvxh2, d5nvxj_, d5nvxk1, d5nvxk2 automated match to d1lqbc_ complexed with 4yy |
PDB Entry: 5nvx (more details), 2.2 Å
SCOPe Domain Sequences for d5nvxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nvxc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerlt
Timeline for d5nvxc_: