![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein Alanine-glyoxylate aminotransferase [89757] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89758] (12 PDB entries) |
![]() | Domain d5lucm_: 5luc M: [339092] automated match to d4kyoc_ complexed with btb, plp |
PDB Entry: 5luc (more details), 1.8 Å
SCOPe Domain Sequences for d5lucm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lucm_ c.67.1.3 (M:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} kllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikegi qyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarvh pmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvns vaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyldi kwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlqa lglqlfvkdpalrlptvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigll gcnatrenvdrvtealraalqhcpkk
Timeline for d5lucm_: