Lineage for d5lucm_ (5luc M:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895694Protein Alanine-glyoxylate aminotransferase [89757] (3 species)
  7. 2895697Species Human (Homo sapiens) [TaxId:9606] [89758] (12 PDB entries)
  8. 2895706Domain d5lucm_: 5luc M: [339092]
    automated match to d4kyoc_
    complexed with btb, plp

Details for d5lucm_

PDB Entry: 5luc (more details), 1.8 Å

PDB Description: crystal structure of the d183n variant of human alanine:glyoxylate aminotransferase major allele (agt-ma) at 1.8 angstrom; internal aldimine with plp in the active site
PDB Compounds: (M:) Serine--pyruvate aminotransferase

SCOPe Domain Sequences for d5lucm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lucm_ c.67.1.3 (M:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
kllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikegi
qyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarvh
pmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvns
vaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyldi
kwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlqa
lglqlfvkdpalrlptvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigll
gcnatrenvdrvtealraalqhcpkk

SCOPe Domain Coordinates for d5lucm_:

Click to download the PDB-style file with coordinates for d5lucm_.
(The format of our PDB-style files is described here.)

Timeline for d5lucm_: