Lineage for d5ly9a_ (5ly9 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042248Superfamily h.4.1: Variant surface glycoprotein (N-terminal domain) [58087] (2 families) (S)
  5. 3042256Family h.4.1.0: automated matches [339070] (1 protein)
    not a true family
  6. 3042257Protein automated matches [339071] (1 species)
    not a true protein
  7. 3042258Species Trypanosoma brucei [TaxId:5702] [339072] (1 PDB entry)
  8. 3042259Domain d5ly9a_: 5ly9 A: [339073]
    automated match to d1vsga_
    complexed with gol, mes

Details for d5ly9a_

PDB Entry: 5ly9 (more details), 1.65 Å

PDB Description: structure of mitat 1.1
PDB Compounds: (A:) Variant surface glycoprotein MITAT 1.1

SCOPe Domain Sequences for d5ly9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ly9a_ h.4.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 5702]}
aertglkatawkplcklttelskvsgemlnegqevisniqkikaaeykvsiylaknpetq
alqqltllrgyfarktngglesyktmglatqirsaraaaylkgsideflnlleslkggse
nkclvttnadtaatrretklddqecalsmpetkpeaatrteltqtgypnlqhggggtant
fqpttstgtckllsghstngypttsaldttakvlagymtipntqveatlanmqamgnghk
atapawheawearnreakakdlaytnetgnldtqptlkalvktlllpkdntehnaeatkl
ealfgglaadktktyldmvdaeiipagiagrtteaplgkihdtvelgdilsnyemiaaqn
vvtlkknl

SCOPe Domain Coordinates for d5ly9a_:

Click to download the PDB-style file with coordinates for d5ly9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ly9a_: