Lineage for d1hwzd2 (1hwz D:1-208)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398612Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 398613Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 398614Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 398615Protein Glutamate dehydrogenase [53225] (7 species)
  7. 398641Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
  8. 398663Domain d1hwzd2: 1hwz D:1-208 [33907]
    Other proteins in same PDB: d1hwza1, d1hwzb1, d1hwzc1, d1hwzd1, d1hwze1, d1hwzf1

Details for d1hwzd2

PDB Entry: 1hwz (more details), 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp

SCOP Domain Sequences for d1hwzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwzd2 c.58.1.1 (D:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1hwzd2:

Click to download the PDB-style file with coordinates for d1hwzd2.
(The format of our PDB-style files is described here.)

Timeline for d1hwzd2: