SCOPe 2.08: Domain d5knpc_: 5knp C:

Lineage for d5knpc_ (5knp C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries)

8. Domain d5knpc_: 5knp C: [339068]
   automated match to d4rhua_
   complexed with 6w7, mg, pop

Details for d5knpc_

PDB Entry: 5knp, 2.45 Å

PDB Description: crystal structure of mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with [3s,4r]-(4-(hypoxanthin-9- yl)pyrrolidin-3-yl)-oxymethanephosphonic acid

PDB Compounds: (C:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5knpc_:

Sequence, based on SEQRES records:

>d5knpc_ c.61.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvtdla
raipvptqfefmavssygsstsssgvvrilkdldrdihgrdvlivedvvdsgltlswlsr
nltsrnprslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtl
dprvyq

Sequence, based on observed residues (ATOM records):

>d5knpc_ c.61.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elypgdiksvlltaeqiqariaelgeqigndyrettgqdlllitvlkgavlfvtdlarai
pvptqfefmavssygsgvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsrnpr
slrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprvyq

Timeline for d5knpc_:

• d5knpc_ first appeared in SCOPe 2.06
  
• d5knpc_ appears in SCOPe 2.07