![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
![]() | Protein automated matches [190891] (38 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries) |
![]() | Domain d5knqb_: 5knq B: [339063] automated match to d4rhua_ complexed with 6w8, mg, pop |
PDB Entry: 5knq (more details), 2.55 Å
SCOPe Domain Sequences for d5knqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5knqb_ c.61.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} elypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvtdla raipvptqfefmavssygsstsssgvvrilkdldrdihgrdvlivedvvdsgltlswlsr nltsrnprslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtl dprvy
Timeline for d5knqb_: