SCOPe 2.08: Domain d5h5lb2: 5h5l B:78-200

Lineage for d5h5lb2 (5h5l B:78-200)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Nilaparvata lugens [TaxId:108931] [268102] (2 PDB entries)

8. Domain d5h5lb2: 5h5l B:78-200 [339061]
   Other proteins in same PDB: d5h5la1, d5h5lb1
   automated match to d2ws2a2
   complexed with edo, gsh, peg

Details for d5h5lb2

PDB Entry: 5h5l, 2 Å

PDB Description: structure of prostaglandin synthase d of nilaparvata lugens

PDB Compounds: (B:) Glutathione s-transferase S2

SCOPe Domain Sequences for d5h5lb2:

Sequence; same for both SEQRES and ATOM records:

>d5h5lb2 a.45.1.0 (B:78-200) automated matches {Nilaparvata lugens [TaxId: 108931]}
agsnewedlmidtmidtfndfrssiskwfresdeatkkkleetllnetvpfyfnkfndhi
knnggylangklswgdiyfisilefmttiwsdiidkyehikalndkvvnlpkikawiekr
pvp

Timeline for d5h5lb2:

• d5h5lb2 first appeared in SCOPe 2.06
  
• d5h5lb2 appears in SCOPe 2.07