Lineage for d5h5la2 (5h5l A:78-199)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2323063Species Nilaparvata lugens [TaxId:108931] [268102] (2 PDB entries)
  8. 2323066Domain d5h5la2: 5h5l A:78-199 [339059]
    Other proteins in same PDB: d5h5la1, d5h5lb1
    automated match to d2ws2a2
    complexed with edo, gsh, peg

Details for d5h5la2

PDB Entry: 5h5l (more details), 2 Å

PDB Description: structure of prostaglandin synthase d of nilaparvata lugens
PDB Compounds: (A:) Glutathione s-transferase S2

SCOPe Domain Sequences for d5h5la2:

Sequence, based on SEQRES records: (download)

>d5h5la2 a.45.1.0 (A:78-199) automated matches {Nilaparvata lugens [TaxId: 108931]}
agsnewedlmidtmidtfndfrssiskwfresdeatkkkleetllnetvpfyfnkfndhi
knnggylangklswgdiyfisilefmttiwsdiidkyehikalndkvvnlpkikawiekr
pv

Sequence, based on observed residues (ATOM records): (download)

>d5h5la2 a.45.1.0 (A:78-199) automated matches {Nilaparvata lugens [TaxId: 108931]}
agsnewedlmidtmidtfndfrssiskwfrdeatkkkleetllnetvpfyfnkfndhikn
nggylangklswgdiyfisilefmttiwsdiidkyehikalndkvvnlpkikawiekrpv

SCOPe Domain Coordinates for d5h5la2:

Click to download the PDB-style file with coordinates for d5h5la2.
(The format of our PDB-style files is described here.)

Timeline for d5h5la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5h5la1