![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) ![]() |
![]() | Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
![]() | Protein automated matches [193326] (11 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:243277] [311867] (9 PDB entries) |
![]() | Domain d5gvza_: 5gvz A: [339057] automated match to d4y2zb_ complexed with act, so4 |
PDB Entry: 5gvz (more details), 1.75 Å
SCOPe Domain Sequences for d5gvza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gvza_ c.56.3.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} qpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqelr vlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghnglkdt isklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilmkdg ltkaqnrlhtfkae
Timeline for d5gvza_: