![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) ![]() |
![]() | Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
![]() | Protein Glutamate dehydrogenase [53225] (8 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries) |
![]() | Domain d1hwzb2: 1hwz B:1-208 [33905] Other proteins in same PDB: d1hwza1, d1hwzb1, d1hwzc1, d1hwzd1, d1hwze1, d1hwzf1 complexed with glu, gtp, ndp |
PDB Entry: 1hwz (more details), 2.8 Å
SCOPe Domain Sequences for d1hwzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwzb2 c.58.1.1 (B:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia dtyastighydinahacvtgkpisqggi
Timeline for d1hwzb2: