Lineage for d1hwzb2 (1hwz B:1-208)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25653Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 25654Protein Glutamate dehydrogenase [53225] (5 species)
  7. 25662Species Cow (Bos taurus) [TaxId:9913] [53230] (3 PDB entries)
  8. Domain d1hwzb2: 1hwz B:1-208 [33905]
    Other proteins in same PDB: d1hwza1, d1hwzb1, d1hwzc1, d1hwzd1, d1hwze1, d1hwzf1

Details for d1hwzb2

PDB Entry: 1hwz (more details), 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp

SCOP Domain Sequences for d1hwzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwzb2 c.58.1.1 (B:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1hwzb2 are not available.

Timeline for d1hwzb2:

Domains from same chain:
(mouse over for more information)
d1hwzb1
Domains from other chains:
(mouse over for more information)
d1hwza1, d1hwza2, d1hwzc1, d1hwzc2, d1hwzd1, d1hwzd2, d1hwze1, d1hwze2, d1hwzf1, d1hwzf2