Lineage for d5y8qa_ (5y8q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941147Species Zoanthus sp. [TaxId:105402] [193832] (10 PDB entries)
  8. 2941170Domain d5y8qa_: 5y8q A: [339041]
    automated match to d1xa9a_

Details for d5y8qa_

PDB Entry: 5y8q (more details), 2.9 Å

PDB Description: zsyellow at ph 8.0
PDB Compounds: (A:) GFP-like fluorescent chromoprotein FP538

SCOPe Domain Sequences for d5y8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y8qa_ d.22.1.0 (A:) automated matches {Zoanthus sp. [TaxId: 105402]}
khglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsag
fkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhks
ifngvnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtv
ykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsal

SCOPe Domain Coordinates for d5y8qa_:

Click to download the PDB-style file with coordinates for d5y8qa_.
(The format of our PDB-style files is described here.)

Timeline for d5y8qa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5y8qb_