Lineage for d1hwza2 (1hwz A:1-208)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1174487Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1174488Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 1174489Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 1174490Protein Glutamate dehydrogenase [53225] (8 species)
  7. 1174498Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
  8. 1174505Domain d1hwza2: 1hwz A:1-208 [33904]
    Other proteins in same PDB: d1hwza1, d1hwzb1, d1hwzc1, d1hwzd1, d1hwze1, d1hwzf1
    complexed with glu, gtp, ndp

Details for d1hwza2

PDB Entry: 1hwz (more details), 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwza2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d1hwza2:

Click to download the PDB-style file with coordinates for d1hwza2.
(The format of our PDB-style files is described here.)

Timeline for d1hwza2: