SCOPe 2.08: Domain d5y11b1: 5y11 B:1-108

Lineage for d5y11b1 (5y11 B:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5y11b1: 5y11 B:1-108 [339037]
   automated match to d1dqdl1
   complexed with man, nag

Details for d5y11b1

PDB Entry: 5y11, 2.1 Å

PDB Description: sftsv gn with neutralizing antibody mab4-5

PDB Compounds: (B:) MAb 4-5 light chain

SCOPe Domain Sequences for d5y11b1:

Sequence; same for both SEQRES and ATOM records:

>d5y11b1 b.1.1.0 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltltqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipa
rfsgsgsgteftltisslqsedfavyycqqynnwppytfgqgtkveik

Timeline for d5y11b1:

• d5y11b1 first appeared in SCOPe 2.06
  
• d5y11b1 appears in SCOPe 2.07