Lineage for d5y1ib_ (5y1i B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (72 species)
    not a true protein
  7. 2332185Species Streptomyces graminofaciens [TaxId:68212] [339025] (1 PDB entry)
  8. 2332187Domain d5y1ib_: 5y1i B: [339026]
    automated match to d1jfba_
    complexed with hem, peg, pge

Details for d5y1ib_

PDB Entry: 5y1i (more details), 2 Å

PDB Description: the crystal structure of gfsf
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d5y1ib_:

Sequence, based on SEQRES records: (download)

>d5y1ib_ a.104.1.0 (B:) automated matches {Streptomyces graminofaciens [TaxId: 68212]}
apewpmkrdtgcpfdpppgvrkllaekplsrariwdgstpwvvtrhadqrallsdprvsh
dglrdgyphisadfkflsmaqpsfagqddpehgrirrmvtlpftarrieamrpaiqkitd
elidgmlagpkpvdlvealalpvpvrvicemlgvpyedreflqqnnnamiyrdtaqgdaq
kaaiaqamylkelvgtklgdrgddilsdlavqveageitqddaagigmmllgaghettan
mialgtlallenpeqlaevrdsddpkvivntveellryltiaqdtvrriaaedieiggvv
ikagegivfplnaanwdpdlypeapdrldihranarrhlafgygvhqclgatlarvelqi
vystllrriptlalagtldeipfkhdqiahgvyelpvtw

Sequence, based on observed residues (ATOM records): (download)

>d5y1ib_ a.104.1.0 (B:) automated matches {Streptomyces graminofaciens [TaxId: 68212]}
apewpmkrdtgcpfdpppgvrkllaekplsrariwdgstpwvvtrhadqrallsdprvsh
dglrdgyphisadfkflspsfagqddpehgrirrmvtlpftarrieamrpaiqkitdeli
dgmlagpkpvdlvealalpvpvrvicemlgvpyedreflqqnnnamiyrdtaqgdaqkaa
iaqamylkelvgtklggddilsdlavqveageitqddaagigmmllgaghettanmialg
tlallenpeqlaevrdsddpkvivntveellryltiaqdtvrriaaedieiggvvikage
givfplnaanwdpdlypeapdrldihranarrhlafgygvhqclgatlarvelqivystl
lrriptlalagtldeipfkhdqiahgvyelpvtw

SCOPe Domain Coordinates for d5y1ib_:

Click to download the PDB-style file with coordinates for d5y1ib_.
(The format of our PDB-style files is described here.)

Timeline for d5y1ib_: