Lineage for d5x3da_ (5x3d A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (53 species)
    not a true protein
  7. 2443442Species Streptomyces wedmorensis [TaxId:43759] [339018] (1 PDB entry)
  8. 2443443Domain d5x3da_: 5x3d A: [339019]
    automated match to d1coza_
    complexed with 7xl

Details for d5x3da_

PDB Entry: 5x3d (more details), 1.93 Å

PDB Description: crystal structure of hep-cmp-bound form of cytidylyltransferase (cytase) domain of fom1 from streptomyces wedmorensis
PDB Compounds: (A:) Phosphoenolpyruvate phosphomutase

SCOPe Domain Sequences for d5x3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x3da_ c.26.1.0 (A:) automated matches {Streptomyces wedmorensis [TaxId: 43759]}
qrpivyvgmsadlihpghinilsraaelgditiglltdaaiasykrlphmtyeqrkavve
nlkgvasvvpqrtldyaenlrtvrpdfvvhgddwqtgvqrhtrervievlsewggklvei
pytpgi

SCOPe Domain Coordinates for d5x3da_:

Click to download the PDB-style file with coordinates for d5x3da_.
(The format of our PDB-style files is described here.)

Timeline for d5x3da_: