SCOPe 2.08: Domain d5vebb1: 5veb B:1-108

Lineage for d5vebb1 (5veb B:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5vebb1: 5veb B:1-108 [339015]
   Other proteins in same PDB: d5veba_, d5vebb2, d5vebh_, d5vebl2
   automated match to d3pgfl1
   complexed with a2g, sin

Details for d5vebb1

PDB Entry: 5veb, 2.34 Å

PDB Description: crystal structure of a fab binding to extracellular domain 5 of cadherin-6

PDB Compounds: (B:) anti-CDH6 Fab light chain

SCOPe Domain Sequences for d5vebb1:

Sequence; same for both SEQRES and ATOM records:

>d5vebb1 b.1.1.0 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyavstlqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsgtfppttfgqgtkveik

Timeline for d5vebb1:

• d5vebb1 first appeared in SCOPe 2.06
  
• d5vebb1 appears in SCOPe 2.07