![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
![]() | Protein automated matches [190580] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188312] (4 PDB entries) |
![]() | Domain d5u1ma_: 5u1m A: [339002] automated match to d1irsa_ |
PDB Entry: 5u1m (more details), 1.8 Å
SCOPe Domain Sequences for d5u1ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u1ma_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcghsenf ffievgrsavtgpgefwmqvddsvvaqnmhetileamramsdafr
Timeline for d5u1ma_: