Lineage for d5u1ma_ (5u1m A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803435Protein automated matches [190580] (4 species)
    not a true protein
  7. 2803438Species Human (Homo sapiens) [TaxId:9606] [188312] (4 PDB entries)
  8. 2803444Domain d5u1ma_: 5u1m A: [339002]
    automated match to d1irsa_

Details for d5u1ma_

PDB Entry: 5u1m (more details), 1.8 Å

PDB Description: structure of the irs-1 ptb domain bound to the juxtamembrane region of the insulin receptor
PDB Compounds: (A:) insulin receptor substrate 1

SCOPe Domain Sequences for d5u1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u1ma_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kevwqvilkpkglgqtknligiyrlcltsktisfvklnseaaavvlqlmnirrcghsenf
ffievgrsavtgpgefwmqvddsvvaqnmhetileamramsdafr

SCOPe Domain Coordinates for d5u1ma_:

Click to download the PDB-style file with coordinates for d5u1ma_.
(The format of our PDB-style files is described here.)

Timeline for d5u1ma_: